PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623675.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 432aa    MW: 48004.9 Da    PI: 5.1726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623675.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed+ll+ +v ++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_013623675.1 22 KGPWTSAEDQLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHL 69
                     79*******************************************996 PP

2Myb_DNA-binding43.57.3e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T  E+++ +++++ +G++ W++ a +++ gRt++++k++w++
   XP_013623675.1  75 KGSFTDKEEQRVIELHASMGNK-WARMATELP-GRTDNEIKNFWNT 118
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8121769IPR017930Myb domain
SuperFamilySSF466893.56E-2821116IPR009057Homeodomain-like
SMARTSM007175.7E-152171IPR001005SANT/Myb domain
PfamPF002493.9E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-242376IPR009057Homeodomain-like
CDDcd001678.07E-122469No hitNo description
PROSITE profilePS5129423.55370124IPR017930Myb domain
SMARTSM007171.1E-1374122IPR001005SANT/Myb domain
PfamPF002499.2E-1375118IPR001005SANT/Myb domain
CDDcd001671.65E-977118No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2377122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MGKVRHDSGS GDEFAIDKAF HKGPWTSAED QLLIAYVDKH GDGNWNAVQK HSGLSRCGKS  60
CRLRWVNHLR PDLKKGSFTD KEEQRVIELH ASMGNKWARM ATELPGRTDN EIKNFWNTRV  120
KRLQRLGLPI YPDEVREQAM NAAAQNGHNA DSLDGHHSQE SLELDCLEIP ELNFKHLQLN  180
GGSSFLQSML SSVPTGNQMR QNPGLFQPNI YNVIASPYHQ PPNRKRFREP ETAFPYTGGY  240
ATDEHSAQLW NSPFVESTPG QFNVAPDSHF LGNATTYSSP SEPLIHGAEK LELPSFQCFD  300
TQEEPGDWEA QHSNPMQAIE SDNTLVLSSP LTDPTPSECP SSFCDGLLES VVYGSSGEKQ  360
TTTTDPDSPL LQSSLLGHID ITPATANTAG HNSSAETDLV HFGPTFSNER RTSFEGGDWI  420
RQLLGEDRDY TK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30221227106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAPTransfer from AT2G26960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765520.0KR076552.1 Brassica napus MYB transcription factor 81-2 (MYB81-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623675.10.0PREDICTED: transcription factor MYB104-like
RefseqXP_013683905.10.0PREDICTED: transcription factor MYB104-like
RefseqXP_013683907.10.0PREDICTED: transcription factor MYB104-like
RefseqXP_013735104.10.0PREDICTED: transcription factor MYB104-like
TrEMBLA0A078HJC00.0A0A078HJC0_BRANA; BnaC03g26620D protein
TrEMBLA0A0D3B7F20.0A0A0D3B7F2_BRAOL; Uncharacterized protein
STRINGBra000531.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.11e-172myb domain protein 81